Protein Info for Pf6N2E2_3787 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR00046: RNA methyltransferase, RsmE family" amino acids 16 to 232 (217 residues), 80.4 bits, see alignment E=6.5e-27 PF04452: Methyltrans_RNA" amino acids 73 to 234 (162 residues), 102.5 bits, see alignment E=9.8e-34

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a397)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1D6 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Pf6N2E2_3787 Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-) (Pseudomonas fluorescens FW300-N2E2)
VNLLLLEEADFIGPDRVILSDRRLTHMQEVHRSAVGDSLRVGRIGGLMGTAQVLRLEARE
AELQVTLDQPPPAKLPLTLVLALPRPKMLRRVFQTIATMGVPRVVLVNSYRVEKSFWQTP
FLEPEAIREQLILGLEQARDSVLPEIIIEKRFKPFVEDRLPAMADDTLGLVGHPGNYPPC
PRALTEPVTLAIGPEGGWIPYEIELLGKAGLQPVQLGERILRVETAVTALLARLF