Protein Info for Pf6N2E2_3784 in Pseudomonas fluorescens FW300-N2E2

Annotation: Twin-arginine translocation protein TatA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 4 to 48 (45 residues), 76.7 bits, E=3.9e-26
• PF02416: TatA_B_E
  • amino acids 6 to 48 (43 residues), 49.5 bits, E=9.9e-18

Best Hits

Swiss-Prot: 82% identical to TATA_PSEF5: Sec-independent protein translocase protein TatA (tatA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03116, sec-independent protein translocase protein TatA (inferred from 97% identity to pba:PSEBR_c2g13)

Predicted SEED Role

"Twin-arginine translocation protein TatA" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

See A0A160A2G9 at UniProt or InterPro

Protein Sequence (95 amino acids)

>Pf6N2E2_3784 Twin-arginine translocation protein TatA (Pseudomonas fluorescens FW300-N2E2)
MGIFDWKHWVVILVVVVLVFGTKKLKNLGTDVGESIKGFRKAMNDDEKPADPSAAASQPA
QPTQPVHPQASQPVNAPHTIDVQAQKVEEPVRKDS