Protein Info for Pf6N2E2_3776 in Pseudomonas fluorescens FW300-N2E2

Annotation: Polyhydroxyalkanoate granule-associated protein PhaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF05597: Phasin" amino acids 9 to 135 (127 residues), 148.2 bits, see alignment E=6.2e-48 TIGR01837: poly(hydroxyalkanoate) granule-associated protein" amino acids 17 to 136 (120 residues), 152.5 bits, see alignment E=2.5e-49

Best Hits

KEGG orthology group: None (inferred from 83% identity to pba:PSEBR_a406)

Predicted SEED Role

"Polyhydroxyalkanoate granule-associated protein PhaF" in subsystem Polyhydroxybutyrate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1C7 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Pf6N2E2_3776 Polyhydroxyalkanoate granule-associated protein PhaF (Pseudomonas fluorescens FW300-N2E2)
MAGKKITEKEGSSWAGKIEKYSRKIWLAGLGVYSKIDTDGSKLFESLVKDGEKAEKLTKT
AVGKQVDAAKGSAESAKSRIGGVKDRALGKWDELEGAFDKRLNSAISRLGVPSRNEVKAL
HSKVDTLTKQIEKLTGAKVAPVATKTAAAKPAAKTAAKPLVKAAAKTAAKPAAKAAAKPA
AKTAAAKPAAKAVAKPVAAKAAAKPAAKPAAKTAAAKPAAKPAAKPAAKATKPAAAKKPA
VKKPAAPKAAAPKAPTAAAKPATPTSTANSAAAPTPVATPTPAPAPTTPTTQS