Protein Info for Pf6N2E2_3768 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cell division protein FtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details PF05036: SPOR" amino acids 153 to 221 (69 residues), 69 bits, see alignment E=1.8e-23

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a414)

Predicted SEED Role

"Cell division protein FtsN" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161H3F8 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Pf6N2E2_3768 Cell division protein FtsN (Pseudomonas fluorescens FW300-N2E2)
LAAKKKPAPKRGASRYQPPAKKPIPGWLWMAIGLTVGAFIVFLMKLEPGQGDDVKRVRQE
QQKATRIAEANKTPPSPTQPVKPKYDFYTLLPESEVIVPPEAVPEKTLPTPQVPTTPVTP
AEAAKIDTARAQAALAGITPPPAPPVQKAAPVTKFFLQAGSFRKEADADKVRAQIILLGQ
SVAVESGTVKDETWYRVLVGPFSNREELTKAQKQLAGSGFSNLLLQQRQSR