Protein Info for Pf6N2E2_376 in Pseudomonas fluorescens FW300-N2E2

Annotation: Similar to non-heme chloroperoxidase, sll5080 homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF12146: Hydrolase_4" amino acids 64 to 164 (101 residues), 52.4 bits, see alignment E=9.5e-18 PF00561: Abhydrolase_1" amino acids 66 to 299 (234 residues), 123.7 bits, see alignment E=2.1e-39 PF12697: Abhydrolase_6" amino acids 68 to 308 (241 residues), 76.7 bits, see alignment E=8.4e-25 PF00326: Peptidase_S9" amino acids 236 to 317 (82 residues), 25.3 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 72% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 99% identity to pba:PSEBR_a3488)

Predicted SEED Role

"Similar to non-heme chloroperoxidase, sll5080 homolog" in subsystem Synechocystis experimental

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YTG5 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Pf6N2E2_376 Similar to non-heme chloroperoxidase, sll5080 homolog (Pseudomonas fluorescens FW300-N2E2)
MNTFNRTLAVATLALATLSAEAASPVQSATSASAVGSVVQSASYITTQDGVQLYYKDWGP
RDGQVVTFSHGWPLDSDSWEGQMMFLASKGYRVVAHDRRGHGRSSQPWEGNDMDHYADDL
AAVIEALDLKDVTLVGFSTGGGEVARYIGRHGTARVKKAVLVSSVPPLMLKTDTNPGGLP
IEVFDGLRKASLENRSQLYLDIASGPFYGYNRKGAKPSQGLIQSFWVQGMQGGSKNTYDS
IAAFSATDFRGDLKKFDVPTLVIHGDDDQIVPIDASGRASAALIKGARLIVYPGAPHGLT
ETHKDRLNQDLLTFLKE