Protein Info for Pf6N2E2_3749 in Pseudomonas fluorescens FW300-N2E2

Annotation: Chitin binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF03067: LPMO_10" amino acids 33 to 206 (174 residues), 132.3 bits, see alignment E=3.3e-42 PF18416: GbpA_2" amino acids 218 to 315 (98 residues), 68.3 bits, see alignment E=6.9e-23

Best Hits

KEGG orthology group: K03933, chitin-binding protein (inferred from 37% identity to asa:ASA_0604)

Predicted SEED Role

"Chitin binding protein" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZYG5 at UniProt or InterPro

Protein Sequence (487 amino acids)

>Pf6N2E2_3749 Chitin binding protein (Pseudomonas fluorescens FW300-N2E2)
MKNNFNKGNVLTGCASSLVLLSAMVASQGVHAHGFVEVPPSRALLCQKGVNLNCGGAQYE
PHSTGETFKGFPNGAGGGPLQGPIDGKIASGGNANFSALDAQSASRWHLTEIRDRNIAFQ
WQYVAAHRTSKHEYFITRDGWKPNQALKRSSFDSTPFCTVDGGHQIPVSGAPHNCVIPDS
KSGHHVILAVWTVGDTDNAFYNPVDVNILAEAALPGGWLPVGSITPSTPLLAGDKVKARA
FSATGENAEYSVEISIDNAEEGKPENWSFKLAEAINTHALIRAGIRGEDGNIAPVKGTNR
LYAQKESGVTGYQVQLDMQEDASASMEISSLQPEYVLDKGRVSMAFTAQTNRRMNLEAAL
FDEKNKQVGTVSQAVGEGSTGLSLDVRSAPGAHTLTLVGTTEDGRTTRQETQTVTLTGEG
AGIEYDFVFPEGISEYTVGTKVLQPKTDEVFACKPFPASGYCKQYSPTSNGFEPGVGASW
QSAWDKL