Protein Info for Pf6N2E2_3743 in Pseudomonas fluorescens FW300-N2E2

Annotation: General secretion pathway protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details PF07963: N_methyl" amino acids 10 to 34 (25 residues), 37.3 bits, see alignment 1.4e-13 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 12 to 35 (24 residues), 33.9 bits, see alignment 1.8e-12 TIGR01710: type II secretion system protein G" amino acids 13 to 150 (138 residues), 184.9 bits, see alignment E=6.7e-59 PF08334: T2SSG" amino acids 38 to 149 (112 residues), 131.7 bits, see alignment E=1.1e-42

Best Hits

Swiss-Prot: 73% identical to GSPG_PSEAE: Type II secretion system protein G (xcpT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02456, general secretion pathway protein G (inferred from 71% identity to pap:PSPA7_1413)

MetaCyc: 51% identical to type II secretion system protein GspG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein G"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZZ0 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Pf6N2E2_3743 General secretion pathway protein G (Pseudomonas fluorescens FW300-N2E2)
MTLQNNRPARPQRGFTLIEIMVVVVIIGILGAIVVPQFMSRPDQAKVTAARTDIQAIATA
LEMYRLDNAQYPSTQQGLEALSKRPSGTPAAKNWNPQGYLKSLPVDPWGTPYQYLNPGLK
ALDGGYDLYSLGADGLLGGEGFAADIGNWAE