Protein Info for Pf6N2E2_3736 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 289 (247 residues), 120.6 bits, see alignment E=1.1e-38 amino acids 249 to 413 (165 residues), 43.3 bits, see alignment E=3.5e-15 PF00083: Sugar_tr" amino acids 72 to 219 (148 residues), 41.6 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 63% identical to YNFM_ECOLI: Inner membrane transport protein YnfM (ynfM) from Escherichia coli (strain K12)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 97% identity to pba:PSEBR_a434)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZHR7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Pf6N2E2_3736 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N2E2)
VKTAVAPLAHEIPPRVQDEVVAELKDIYIEKGTPMFMRTVLALFSGGFATFALLYCVQPM
MPLLSTEFSINAAQSSLILSVATGLLAIGLLITGPISDRIGRKPVMVAALFAASVCTIAS
AMMPTWHGVLLLRALVGLSLSGLAAVAMTYLSEEIHPKHIGLAMGLYIAGNAIGGMCGRL
ITGVLIDFVSWHTAMLVIGGLALIAAAVFWRILPESRNFRPRSLHPRSLLDGFIMHFRDA
GLPLLFLEAFVLMGAFVTLFNYIGYRLLAEPYHLDQAFVGLLSVVYLSGIYSSAKIGALA
DKLGRRKMLWATIALMLAGLALTMATPLWLVVLGMLVFTFGFFGAHSVASSWIGRRALKA
KGQASSLYLFSYYAGSSVAGTAGGVAWHLGGWNGVGLFIGTLLVVALLVAVKLAKLPLLP
GNVQV