Protein Info for Pf6N2E2_3734 in Pseudomonas fluorescens FW300-N2E2

Annotation: Queuosine Biosynthesis QueC ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06508: QueC
  • amino acids 7 to 217 (211 residues), 270.5 bits, E=4.4e-85
• TIGR00364: queuosine biosynthesis protein QueC
  • amino acids 8 to 210 (203 residues), 273 bits, E=6.5e-86

Best Hits

Swiss-Prot: 78% identical to QUEC2_PSEF5: 7-cyano-7-deazaguanine synthase 2 (queC2) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 78% identity to pfl:PFL_5031)

MetaCyc: 69% identical to 7-cyano-7-deazaguanine synthase (Escherichia coli K-12 substr. MG1655)
RXN-12093 [EC: 6.3.4.20]

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.20

Sequence Analysis Tools

See A0A160A197 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Pf6N2E2_3734 Queuosine Biosynthesis QueC ATPase (Pseudomonas fluorescens FW300-N2E2)
MNEMTKKAVIVFSGGQDSTTCLIHALPRYDEVHCITFDYGQRHRQEIEVAQQLCKALGVT
VHKILDTTLLNELAISSLTRDNIPVPAANSDGDGLPSTFVPGRNILFLTLASIYAYQVGA
KTLITGVCETDFSGYPDCRDAFVKALNNAIELGMDYPLRIETPLMWLNKAQTWALADYHG
WLEFIDQQTLTCYNGIKGRGCGDCAACHLRAKGLSHYLENRVEIMNSLKTKLDL