Protein Info for Pf6N2E2_3721 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG021862: membrane protein, exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 246 to 265 (20 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details amino acids 630 to 650 (21 residues), see Phobius details amino acids 657 to 675 (19 residues), see Phobius details amino acids 681 to 700 (20 residues), see Phobius details amino acids 708 to 731 (24 residues), see Phobius details amino acids 737 to 757 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a448)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A095 at UniProt or InterPro

Protein Sequence (772 amino acids)

>Pf6N2E2_3721 FIG021862: membrane protein, exporter (Pseudomonas fluorescens FW300-N2E2)
MLPRLFLILLLAVLALAGWQWRNGAPLSANLMELVPGTSPDALELIAEQRMQEPLNREML
VLVGHTDRQQAIALAQTLGEQWQASGLFDKVQWTLQADLPALRTQLLNGRLAMLSAADRQ
QLIEQPQAFIQQRVQALFDPFSGFSLVPNQDDWLGLTGRIQNSQPQRGAIKFDIGSGALV
ADADGKSWVMLRARAQGNAFDMNLPLQVAELLQRSRDQASQAQGQLLAASGLLYAASGQQ
QASREITWVGGGATVGILLLLLLAFRRLRVWLAFVPVLVGVLFGAVACVALFGRMHVMTL
VLGSSLIGVAVDYPLHYLSKSWSLKPWRSWPALRLTLPGLSLSLVTTCIGYLALAWTPFP
ALTQIAIFSAAGLVGAYLSAVCLLPALLKGAELRPAQWPLQVCQYLLKAREALLKRVRTP
ALLMLLLMFCAGGLWHLTPKNDIRQWIGTPQHLTDEARDIARITGFQPTSQFFLIRADDQ
SQLLERQTALNERLDQLIGLEKLQGYLSLNQLVSPPAEQQKVREALGRLPAVWQPLLDLG
VPVAALQAELAQLQALPVTDIDAALAGPLAEPYRTLWLGPTAQGVAAVVSLQGLNDAALL
RIQAVDLPGVQLVDRLGDLNRVFAATQVSAAELKLASCVLIVLVLIWPFGVGGALRIVAL
PLLAALCSLASLGWLGQPLTLFSLFGLLLVTAIGVDYAILMREQIGGAAVSLLGTFLAAV
TTWLSFGLLALSSTPAVSNFGLAVSLGLAFSFMLAPWAGQQAHAATVAEPAQ