Protein Info for Pf6N2E2_3701 in Pseudomonas fluorescens FW300-N2E2

Annotation: Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF02492: cobW" amino acids 6 to 184 (179 residues), 143 bits, see alignment E=8.4e-46 PF07683: CobW_C" amino acids 231 to 320 (90 residues), 76.3 bits, see alignment E=1.4e-25

Best Hits

KEGG orthology group: None (inferred from 78% identity to pst:PSPTO_4198)

Predicted SEED Role

"Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A275 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Pf6N2E2_3701 Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family (Pseudomonas fluorescens FW300-N2E2)
MSIALNVMTGFLGSGKTTLLNRLLQDESLGDTALLINEFGDIGIDHLLVQEVAPDTVLLP
SGCVCCSIRGELKDALLDLLARRDRGEIPAFRRVILETTGLADPAPILATLNNDVQLRGR
FHIGLVVTLVDACHAELQARIHPEWLAQVAAADRLLLSKTDQVAAPVVSALRQRLQALNP
GAPLLDTHDVLSGDQLLLGEGLRGATPEVEVARWQLHRPQGQVTQHGQAQVCCLTFDQPL
DWIGFGVWLSMLLRCHGERILRVKGLLNVNSLQAPVVIHGVQHCLHAPVHLPHWPCAERQ
SRLVFIVRGLDPERLRHSFDVFARCFAPAVEVSA