Protein Info for Pf6N2E2_3679 in Pseudomonas fluorescens FW300-N2E2

Annotation: Protein involved in catabolism of external DNA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04378: RsmJ
  • amino acids 32 to 276 (245 residues), 326.3 bits, E=5.3e-102

Best Hits

Swiss-Prot: 43% identical to RLMJ_HAEIN: Ribosomal RNA large subunit methyltransferase J (rlmJ) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07115, (no description) (inferred from 100% identity to pba:PSEBR_a478)

MetaCyc: 45% identical to 23S rRNA m6A2030 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6998 [EC: 2.1.1.266]

Predicted SEED Role

"Protein involved in catabolism of external DNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.266

Sequence Analysis Tools

See A0A159ZZV1 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Pf6N2E2_3679 Protein involved in catabolism of external DNA (Pseudomonas fluorescens FW300-N2E2)
MNYRHAFHAGNHADVFKHLTLTRLIALMSRKEQPFAYLDTHAGIGLYDLQGDQANRTGEY
LEGIARLWGESDLPPLTADYMKVLHEMNPDGQLRYYPGSPELARRLTRSQDRVLLNEKHP
EDGVLLKDNMKGDRRVAVHLGEGWHVPRALLPVAEKRALMLIDPPFEQPDEMQRCAASLK
EAIGRMRQTVAAIWYPVKDQRMLRRFYQDLAGTGAPKLLRVELLVHPLATPNSLNGSGLA
IANPPWGLEEELRELLPWLSKKLGQTQGGWQMDWLIAES