Protein Info for Pf6N2E2_3658 in Pseudomonas fluorescens FW300-N2E2

Annotation: Lipid A core - O-antigen ligase and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 53 to 69 (17 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 195 to 211 (17 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 352 to 370 (19 residues), see Phobius details PF04932: Wzy_C" amino acids 184 to 303 (120 residues), 55.8 bits, see alignment E=2.4e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A142 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Pf6N2E2_3658 Lipid A core - O-antigen ligase and related enzymes (Pseudomonas fluorescens FW300-N2E2)
VWASIGFLILLCGPWVLPSNKLYHQMLIVLLWLPALLALFHRDFRLLLKQPECIFFLLFV
AWTFLVLAVEGGDNVFGKVKVTFYVALTLAGVLLAAQNRKWRLESMLLYASIIGGVFAAA
SWACFYGLSARSLHSRVIAIGLWDTAIMAAHAVGALAIMGAFTLRTRRFPPVVMALLLIP
AIGYALFLGFSQTRGVWIGLAVCFLVMAVARPSRLGSGLILLGALGVACIALFKPEVLLQ
RGVSYRPELWRGGIQLILDHWVTGLGFKEYLIPVPEIGRSFKHPHNLFLDAGVRLGVPGL
LLFGWLWLVAGWRGWISRAQPLGQVLLALWVFSGASLMTDGIGLWLKPNADWLVMWLPIA
LSIVLAAREGAETKSSI