Protein Info for Pf6N2E2_3656 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable transcription regulator Mig-14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF07395: Mig-14" amino acids 36 to 299 (264 residues), 395.4 bits, see alignment E=1.2e-122 PF13480: Acetyltransf_6" amino acids 144 to 287 (144 residues), 39 bits, see alignment E=8.8e-14

Best Hits

KEGG orthology group: None (inferred from 80% identity to pmy:Pmen_0595)

Predicted SEED Role

"Probable transcription regulator Mig-14"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZWT8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Pf6N2E2_3656 Probable transcription regulator Mig-14 (Pseudomonas fluorescens FW300-N2E2)
LILSYWRSWRESGWTPIDAVAYAQAWQQFGGSVATHPNVVERLAGLVGIPVRYLGWFVDG
QLCAAIPTWGRHVALSKDVLKREGKRGMLDLGNAEVILPVAEDARIRVRHRMRYVSELNA
RNVTGLAEQPEGLALAREPEEYSKKFRYNQRREQRLLEDAGGIIRPMLELSASEQAAIYA
DLFQRRWNFEAPGKKHLADVFGLMREFMTGSLIYLNDEPVAIQILYRVEAPKWTSLEYIN
GGVDPQSREFSPGSVLSFVNTQTAWEQARALGKPLRYSFGRADREYKDRWCHRVPVYQV