Protein Info for Pf6N2E2_3637 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): yqiA-like hydrolase, affects the cell envelope
Rationale: PFam PF05728.8 (UPF0227). conserved phenotypes: important for resisting doxycycline and for octanoate utilization (also a putative stress)
Original annotation: Putative esterase, FIGfam005057

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05728: UPF0227
  • amino acids 4 to 187 (184 residues), 214.2 bits, E=1.6e-67
• PF12697: Abhydrolase_6
  • amino acids 41 to 162 (122 residues), 26.6 bits, E=9.1e-10

Best Hits

KEGG orthology group: K07000, (no description) (inferred from 96% identity to pba:PSEBR_a519)

Predicted SEED Role

"Putative esterase, FIGfam005057"

Sequence Analysis Tools

See A0A160A230 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Pf6N2E2_3637 yqiA-like hydrolase, affects the cell envelope (Pseudomonas fluorescens FW300-N2E2)
MSGSILYIHGFNSAPASTKASQLINVMAQLGLSDHLQVPALHHHPRQAIGQLEQAIAQLG
RPLLVGSSLGGYYATHLAERHGLKALLINPAVSPHRMFDGYLGTQKNLYTDETWELTHDH
VTALAELDVPAPRDPQRFQVWLQTGDETLDYRHAQQYYRACALRIQAGGDHSFQGFAQQL
PALLSFAGIGADLYQAIDFTSL