Protein Info for Pf6N2E2_361 in Pseudomonas fluorescens FW300-N2E2

Annotation: Peptide ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 162 (28 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 9 to 103 (95 residues), 54.1 bits, see alignment E=1.7e-18 PF00528: BPD_transp_1" amino acids 118 to 316 (199 residues), 122.3 bits, see alignment E=2e-39

Best Hits

Swiss-Prot: 36% identical to Y1050_BRUA2: Putative peptide transport system permease protein BAB2_1050 (BAB2_1050) from Brucella abortus (strain 2308)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to pba:PSEBR_a3503)

Predicted SEED Role

"Peptide ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YT09 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Pf6N2E2_361 Peptide ABC transporter, permease protein (Pseudomonas fluorescens FW300-N2E2)
MNSNTLWLIGRRLGAAVVTLLIVSMVVFAITAVLPGDAAQQSLGQFATPEQVAALRVKMG
LDQPGVLRYLHWLMSLLSGDMGVSISNATPVSELMAGRVPNTLMLAAATALVSVPVALIL
GIGSAMGRGGRIDGFLSFFTLTMVAVPEFLVATLAVLIFAVNLGWLSALSYSSEITSPLQ
FMRTYALPVMTLCCVIVAQMARMTRAAVIDQLDSPYVEMARLKGVSPVRVVLRHALPNAI
GPIANAIALSLSYLLGGVVIVETIFNYPGIASLMVDAVTNRDMALVQACTMLFCTAYLAL
VLVADLCAILSNPRLRNQ