Protein Info for Pf6N2E2_3606 in Pseudomonas fluorescens FW300-N2E2

Annotation: 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00186: RNA methyltransferase, TrmH family, group 3" amino acids 4 to 243 (240 residues), 267.5 bits, see alignment E=4.9e-84 PF08032: SpoU_sub_bind" amino acids 6 to 79 (74 residues), 69 bits, see alignment E=3.7e-23 PF00588: SpoU_methylase" amino acids 97 to 237 (141 residues), 143.5 bits, see alignment E=5e-46

Best Hits

Swiss-Prot: 92% identical to RLMB_PSESM: 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (rlmB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 100% identity to pba:PSEBR_a549)

MetaCyc: 58% identical to 23S rRNA 2'-O-ribose G2251 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11588 [EC: 2.1.1.185]

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.185

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0Z2 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Pf6N2E2_3606 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) (Pseudomonas fluorescens FW300-N2E2)
MSLEKIYGVHAVEALLRHHPKRVKQVWLAEGRSEPRVQALVELATQNKVAIGQAERREMD
VWVEGVHQGVVADVSPSQVWGEAMLDELLDRTEGAPLLLVLDGVTDPHNLGACLRSADAA
GALAVIVPKDKSATLTPAVRKVACGAAEVIPLVAVTNLARTLEKLQQRGLWVVGTAGEAE
VSIYDQDLTGPTILIMGAEGKGMRRLTREHCDYLVKLPMAGSVSSLNVSVATGVCLFEAL
RQRSVKAVAKKP