Protein Info for Pf6N2E2_3561 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphate starvation-inducible protein psiF precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07769: PsiF_repeat" amino acids 23 to 55 (33 residues), 70.9 bits, see alignment E=3.2e-24 amino acids 61 to 93 (33 residues), 68.3 bits, see alignment E=2e-23

Best Hits

Swiss-Prot: 53% identical to PSIF_ECOL6: Phosphate starvation-inducible protein PsiF (psiF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a588)

Predicted SEED Role

"Phosphate starvation-inducible protein psiF precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1W7 at UniProt or InterPro

Protein Sequence (95 amino acids)

>Pf6N2E2_3561 Phosphate starvation-inducible protein psiF precursor (Pseudomonas fluorescens FW300-N2E2)
MKMLRVPLLMIGLLLCSQGFAETAQQTKMTTCNADATAKALKGDERKAFMSTCLKATAAP
STPQERMKTCNATATTQALKGDARKAFMSECLKKK