Protein Info for Pf6N2E2_3542 in Pseudomonas fluorescens FW300-N2E2

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 708 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details PF07715: Plug" amino acids 70 to 172 (103 residues), 49.8 bits, see alignment E=4.4e-17 TIGR01778: TonB-dependent copper receptor" amino acids 73 to 708 (636 residues), 968.2 bits, see alignment E=1.3e-295 PF00593: TonB_dep_Rec_b-barrel" amino acids 226 to 666 (441 residues), 174.4 bits, see alignment E=8e-55

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 98% identity to pba:PSEBR_a609)

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZQ1 at UniProt or InterPro

Protein Sequence (708 amino acids)

>Pf6N2E2_3542 Outer membrane receptor proteins, mostly Fe transport (Pseudomonas fluorescens FW300-N2E2)
MSRFSAGTALGSAQVRCPLNEPRVRLRQTIAALCGLLLTPYALADEHDHHDHQVEELSPT
VITAIAPSSPLTVVTNPKDPRQPVPASDGGDYLKTIPGFALVRNGGTNGDPVLRGMFGSR
LNILTNGSMLLGACPGRMDAPTSYISPETYDMLTVIKGPQTVLWGPGASAGTVLFEREPE
QFGELGTRVNASVLAGSNGRFDKVVDAAAGGPLGYVRVIGNTAHSDDYRDGNNDTVPSRY
DKWNGDVTLGWTPDADTLLELTAGKGDGEARYAGRGMDGSQFKRESLGLRFERSNIGEVL
DKVEAQVYYNYADHVMDNYTLRTPSGTGMMAGPMASNVDRRTLGARIKATWRWADVQLIS
GLDAQTNEHRQRSSMGVDTYKDLPYTKDADFHNYGVFGELTWYAADRDRVITGARLDRAS
AKDYRQSTGSGMSARPNPTADDTRADTLPSGFVRYEHDLDDSPTTLYAGVGHAQRFPDYW
ELFSANVGPSGSLNAFDAIKPEKTTQLDFGLQYKTETLEAWASAYVGQVRDYILFDYTPG
MMGTTSRAENIDARIMGGELGAAYKLSERWKADATLAYAWGKNSSDGSALAQMPPLDARL
GLTYSEDRWSAGALWRVVAAQHRVDENKGNVVGKDYGKSSGFGVFSLNGAYRINKHWKVS
SGVDNLFGKAYAEHLNLAGNAGFGYPASDPQAINEPGRTLWTKVDMSF