Protein Info for Pf6N2E2_3536 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cobalt-precorrin-6 synthase, anaerobic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF01888: CbiD" amino acids 12 to 271 (260 residues), 301.9 bits, see alignment E=1.7e-94 TIGR00312: cobalamin biosynthesis protein CbiD" amino acids 19 to 318 (300 residues), 206.7 bits, see alignment E=2.2e-65

Best Hits

Swiss-Prot: 91% identical to CBID_PSEPF: Cobalt-precorrin-5B C(1)-methyltransferase (cbiD) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02188, cobalamin biosynthesis protein CbiD (inferred from 98% identity to pba:PSEBR_a614)

MetaCyc: 36% identical to cobalt-precorrin-6A synthase (Salmonella enterica enterica serovar Typhimurium)
RXN-8764 [EC: 2.1.1.195]

Predicted SEED Role

"Cobalt-precorrin-6 synthase, anaerobic" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.195

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZI7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Pf6N2E2_3536 Cobalt-precorrin-6 synthase, anaerobic (Pseudomonas fluorescens FW300-N2E2)
MRDETAEQPAPLRSGLTTGSCATATSLAAARLLLRGTEADAVEIVLPKGKHVQMRLEFCR
LTEQGAEAGTIKDAGDDPDVTHGALLFSQVRLIAEPGVRFVAGRGVGTVTRPGLVLEVGE
PAINPVPRKMINDHLSRLAQDSGYAGGFEVTVNVEGGEALALKTMNPRLGILGGLSILGT
SGIVRPFSCAAYIASIHQGIDVAKTNGYLHIAACTGNASEDTMRRVYNLPEIALIEMGDF
VGAVLKHVRKVPVEKLSLCGGFGKISKLAAGHMDLHSRHSSIDLPQLAEWAAAIGADEAL
QQGIRAANTSQQALAMASAAGIALGDAVCAHALAFARSVVPAQVQVEVFAIDRQGGIVGH
AGELR