Protein Info for Pf6N2E2_3534 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cobalamin biosynthesis protein CobG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR02435: precorrin-3B synthase" amino acids 1 to 381 (381 residues), 384.3 bits, see alignment E=3.2e-119 PF03460: NIR_SIR_ferr" amino acids 12 to 69 (58 residues), 39.8 bits, see alignment E=3.2e-14 amino acids 241 to 305 (65 residues), 54.8 bits, see alignment E=6.4e-19 PF01077: NIR_SIR" amino acids 78 to 217 (140 residues), 60.9 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: K02229, precorrin-3B synthase [EC: 1.14.13.83] (inferred from 92% identity to pba:PSEBR_a616)

Predicted SEED Role

"Cobalamin biosynthesis protein CobG" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1Y0 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Pf6N2E2_3534 Cobalamin biosynthesis protein CobG (Pseudomonas fluorescens FW300-N2E2)
LLRVVQALDGGICRIKLDGGSIRADQADAVAAAAERFAAGVIEATNRGNLQIRGIGPEHG
ALIEQLLAAGLGPRTPAGDDVRNLMLSPSAGIDRQMLLDTRPLAAQILVTLQTHERFHEL
SAKFAVQLDGGEALAMLEHHHDLWLSALVRNGEPWLAFGLAGTPLDKPAGKVPLTQGHAL
VVAVLELFLDLARPDQIRMRHLLAEVSVDEFMTRLARRVPLQACLDWQRDASIDGLHLGV
HPQHDDRVYVGAAAPLGRLDAVMLRGAAQLAREKGDESLSFTPWQSLLLPNVRSEDADQV
LARLEGLGLLCSLDQPLAQLIACTGSSGCGKALADTKADARQLAELLQRQGQTLKVHLSG
CPRSCAAAHVAPATLLAVAPGRYDLYFRDATLPGFGALQAHNLTIEALGHWLDARSRSPL
DA