Protein Info for Pf6N2E2_3521 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 929 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 172 to 189 (18 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 30 to 160 (131 residues), 66.7 bits, see alignment E=5.3e-22 PF07695: 7TMR-DISM_7TM" amino acids 171 to 373 (203 residues), 94.7 bits, see alignment E=1.9e-30 PF00512: HisKA" amino acids 397 to 462 (66 residues), 73.6 bits, see alignment 2.7e-24 PF02518: HATPase_c" amino acids 509 to 623 (115 residues), 56.7 bits, see alignment E=7.8e-19 PF00072: Response_reg" amino acids 643 to 759 (117 residues), 69.9 bits, see alignment E=5.2e-23 amino acids 793 to 907 (115 residues), 81.4 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a625)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1X2 at UniProt or InterPro

Protein Sequence (929 amino acids)

>Pf6N2E2_3521 Sensor histidine kinase/response regulator (Pseudomonas fluorescens FW300-N2E2)
VRWLRIAIGLTVTLLTLLCMLPAQAAPGSGWAVLLDEQGDLTLSDIRSARYTNQFSPIDL
DRLQAAEPGGALWLRFRLAPDRHEQILRIFAPDLSRLNLYVLDGDTLVDQQVSGNATPHT
EPAVPSNDLMLPLPRSDKSLDVYLRLSSRHELRPYITLQSAVVAAADQNQTLIYGLLFGC
IAMLVLHNLTRYAYTRSRSCLWLAACEGLLMLSLALLLNLAGAWLPDWPAVQTPGAYLAL
LLTAPCGLMFAYRFFAPLGPHPLNRLLLGDIVLVMLCSLLLLFVNTLPLNIMTYALVALA
GLSMLLVSAWHWQKGYRPARLFVAAMVVFNLGTLIILPALQGLTEVPPQGLIITLLIFIC
ISGLLMSVALGERQRSINESRFSISRDLAASNAEINAKAEFLAKISHEIRTPMNGVLGMT
ELLLGTPLSVKQRDYVQTIHSAGNELLTLINEILDISRLESGQIELDDVQFDLNALIEDC
LSIFRAKAEQQNVELISFIQPQVPRVISGDPTRLRQALLSLLENALKKTDEGEVLIVVAL
DERSNQPRLRIAVQDSGTPMDAEERDTLMHAELHSKNFLSATRLGGNLGLVIARQLIILM
HGEFGIKSGSNQGSTLWLTLPLDPDRLEHPTADLDGPLQGARVLIVDDNDTCRKVLVQQC
SAWGLNVSAVPSGKEALALLRTKAHLRDYFDVVLLDQNMPGMTGMQLAAKIKEDPSLNHD
ILLIMLTGISNAPSKIVARNSGVKRILAKPVAGYTLKTTLADELNQRNRGQATNVQVNAG
PPLPVKVPSDFRILVAEDNSISTKVIRGMLGKLNLQPDTASNGEEALKAMKEQRYDLVLM
DCEMPILDGFSATQQLRAWEMGNQRTRTPVVALTAHILAEHKERARQAGMDGHMAKPVEL
SQLRELIEHWVAQRDQQNQTVAHSSEGVR