Protein Info for Pf6N2E2_352 in Pseudomonas fluorescens FW300-N2E2

Annotation: Opine oxidase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 6 to 6 (1 residues), see Phobius details transmembrane" amino acids 7 to 23 (17 residues), see Phobius details PF01266: DAO" amino acids 7 to 355 (349 residues), 243.4 bits, see alignment E=1.4e-75 PF13450: NAD_binding_8" amino acids 10 to 37 (28 residues), 26.5 bits, see alignment (E = 1.6e-09)

Best Hits

KEGG orthology group: K00303, sarcosine oxidase, subunit beta [EC: 1.5.3.1] (inferred from 98% identity to pba:PSEBR_a3510)

Predicted SEED Role

"Opine oxidase subunit B"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YSQ9 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Pf6N2E2_352 Opine oxidase subunit B (Pseudomonas fluorescens FW300-N2E2)
MKPEKSDVLIIGGGIMGSASAFFLRQRGHSVTLLERDLIGQYASGVNFGNVRRQGRFLGQ
LELSNRSYGLWKRLPELIGDDLEFIPSGHMRVCYREDEIAELEAYAAAPEARELDLQIIT
GKALHARFPFLGAEVKGGSYAPHDGHANPRLAAPAFARAATRAGASIRERTEVATVRKEN
DHFHVTTTNGQLFIAEQLLITAGAWGAKLSEQFDEAVPLQANGPQMSVTEPVPYALPTVI
GVFTKIKEEVIYFRQIPRGNLIIGGGNRCKPDMINRRAYFKPESLLNQMQQMSRLLPGVA
NLNIIRVWSGIESYTPDSLPIMGPSGKVKGLFYAFGFCGHGFQLGPGVGDVMAELISTGS
TRTLISPFDIRRFTEPTALTMPQMSTPGTGRLI