Protein Info for Pf6N2E2_3515 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 242 to 260 (19 residues), see Phobius details PF13719: zinc_ribbon_5" amino acids 6 to 41 (36 residues), 36.6 bits, see alignment 3.1e-13 TIGR02098: MJ0042 family finger-like domain" amino acids 6 to 41 (36 residues), 57.7 bits, see alignment 3.5e-20 PF13717: zinc_ribbon_4" amino acids 7 to 40 (34 residues), 35.1 bits, see alignment 1.1e-12

Best Hits

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>Pf6N2E2_3515 Probable transmembrane protein (Pseudomonas fluorescens FW300-N2E2)
MTDSFVTQCPHCHTRFRVSHAQLSVARGVVRCGSCLQVFNAARQLLEQRTAKQAAPAVVP
TSKPAVEAPPRAISQKQWSAAELDLDDLDKELARLERRDNRAPGNTGRRREDNLSAQRDS
LSSEQQAWPDSLYSESSSERAEAVLQDTIEPFEPHEPARPPRTEPSLSLALEPLEPDDEP
DEHLERLSATDDHDDEPEQLAPLRKSRERQEPGIRAEALHDLDDDPLQLDWRKRRSPWGR
RLLWGLLILLASAALGGPVHRLPFRRTGPPGPVPAVVPANLSDHRLRSTVQGRHRQDQEQ
QPGGAQPSGVQRCPGGGRDHLQPCALLPTFSIAGTALCRPQRTPDRQPSLQARRVPGWRP