Protein Info for Pf6N2E2_3474 in Pseudomonas fluorescens FW300-N2E2

Annotation: Calcium/proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 165 to 191 (27 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 282 to 306 (25 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 41 to 184 (144 residues), 46.7 bits, see alignment E=1.7e-16 amino acids 218 to 360 (143 residues), 30.6 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: K07300, Ca2+:H+ antiporter (inferred from 98% identity to pba:PSEBR_a669)

Predicted SEED Role

"Calcium/proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXT2 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Pf6N2E2_3474 Calcium/proton antiporter (Pseudomonas fluorescens FW300-N2E2)
MLTLLKQEKLLLLALIAACIAYPLEHWLLGNGQRVALISGLVLIGFIVAASMRVAHHAEL
LAEKVGDPYGTMILTLSAVLVEVVILAIMMSNEASSTLVRDTIYSAVMLDINGILGLAAL
MGGIKHGEQAYNDDSARTYSVMILTAMGVSMVVPEFIPRESWKMYSAFTIGAMIVLYTLF
LRMQVGPHSYFFSYSYPEKRRKKEPVENEPEPISLALSIGALVVGVVIIGALAEVMSKAL
DLGLEGSGAPPVVTAILVAAISAAPEILTALRAALANRMQSVVNIALGASLSTVILTVPV
MEAMALYTGQPFQMAMTPVQTVMIFITLIVSAINLNDGETNAIEGMTHFVLFATFIMLSL
LGL