Protein Info for Pf6N2E2_3469 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nucleoside ABC transporter, permease protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 220 to 236 (17 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 264 to 265 (2 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 15 to 281 (267 residues), 117.1 bits, see alignment E=4.1e-38

Best Hits

Swiss-Prot: 47% identical to TSGCD_HALVD: Putative glucose ABC transporter permease protein TsgC13 (tsgC13) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to pba:PSEBR_a674)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0N8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Pf6N2E2_3469 Nucleoside ABC transporter, permease protein 2 (Pseudomonas fluorescens FW300-N2E2)
MDIDLLSNIFYAMVRCGTPLLLVALGELVCEKSGVLNLGQEGMMLFGAVIGFIVAFNSGN
LWLGVLLAMAAGMLLSALFALVALVFNANQVATGLALTIFGVGLSSFVGAAWVGKPLAGF
EPLAIPYLSDIPLIGRMLFAQDLLVYLSFALFALVAWMIVKSRVGLIIQAVGENPDAASA
MGLPVLRVRTLAVLFGGAMAGLAGAYLSLAYTPMWAENMSAGRGWIALALVVFASWRVWR
LLLGAYLFGLASILHLVAQGLGLAIPSSLLAMLPYAATIVVLVLLSRDAVRTRLYAPVSL
GQPWQSGH