Protein Info for Pf6N2E2_3468 in Pseudomonas fluorescens FW300-N2E2

Annotation: Nucleoside ABC transporter, permease protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 281 to 312 (32 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 338 (278 residues), 180.2 bits, see alignment E=2.3e-57

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to pba:PSEBR_a675)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZD9 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Pf6N2E2_3468 Nucleoside ABC transporter, permease protein 1 (Pseudomonas fluorescens FW300-N2E2)
MLLSLEPRGQQSRLMLWCSPLLAAVLTLACGSLLFIALGHDPLQTLYTLLIAPISDLYGV
SEWLVKTLPILLCALGLAVAYQARIWNIGAEGQLLLGALAGSALAVNIIDVQSRWALVLI
LLTGTLAGAAWAGLTAWLRTRFNANEILTSIMLNYIALNLLLFCVHGPLKDPAGFNFPES
AMFGEASRLPLLLEDGRVHAGLYFALLALVAVWVLLQKSFVGFQIKVLGLDARAAGFAGF
RQKPLVWLALLISGALAGLAGVCEVTGPIGQLVPQVSPGYGYAAITVAFLGRLNPIGILF
SSLLMALLYIGGESAQMSLNLPQAITQLFQGMMLFFLLACDVLILYRPRLNLRWARRTRT
TAVQAGAL