Protein Info for Pf6N2E2_3456 in Pseudomonas fluorescens FW300-N2E2

Annotation: Inner membrane protein YfiN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details PF17152: CHASE8" amino acids 43 to 143 (101 residues), 107.7 bits, see alignment E=4.9e-35 PF00672: HAMP" amino acids 181 to 230 (50 residues), 26.2 bits, see alignment 1.2e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 243 to 404 (162 residues), 147.9 bits, see alignment E=1.1e-47 PF00990: GGDEF" amino acids 247 to 401 (155 residues), 158.5 bits, see alignment E=1.9e-50

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a686)

Predicted SEED Role

"Inner membrane protein YfiN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0M7 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Pf6N2E2_3456 Inner membrane protein YfiN (Pseudomonas fluorescens FW300-N2E2)
MSLSKSRIRPTLGSVIGRGHLIVALVAITMASVSLTLLGVLALRVYADHNLHLIARSINY
TVEAAVVFDDPAAATEALALIASTEEVADAQVFNKHGRLLARWQRPETGLLSGLEVHIAK
AFLEKPISLPIVHQGRNIGSILLAGHGGSLLRFLLSGLAGIILCTAVSAWVALYLARRQL
RAITGPLRSLAEVAHAARSERALDRRVPPAAIAELDNLANDFNALLDELESWQTHLQSEN
ETLAHQASHDSLTGLPNRAFFEGRLIRALRNASKLNEQVAVLYLDSDRFKGINDNFGHAA
GDAVLTAVATRVRAQLREDDLVARLGGDEFAVLLAPLHKAEDAERIAEKIIASMEMPIQL
PGNASVLTSLSIGIAVYPDDGATPGTLLHAADAAMYQAKRLARGGQHTAGSDHSVADLQT
RS