Protein Info for Pf6N2E2_3443 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 53 (18 residues), see Phobius details amino acids 59 to 75 (17 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 350 to 378 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 6 to 134 (129 residues), 87.3 bits, see alignment E=1.8e-28 amino acids 158 to 354 (197 residues), 105.8 bits, see alignment E=4.5e-34 PF01740: STAS" amino acids 394 to 479 (86 residues), 37.9 bits, see alignment E=2.7e-13 PF13466: STAS_2" amino acids 402 to 479 (78 residues), 30.3 bits, see alignment E=8.1e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a698)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZFV8 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Pf6N2E2_3443 Sulfate permease (Pseudomonas fluorescens FW300-N2E2)
MKPARLRADALAGLTTSFALLPECIAFALVAHLNPLMGLYGAFIICTLTALFGGRPGMVS
GAAGSMAVVIIALVVQHGVQYLLATVLLGGLIMMAFGLLRLGKLVRMVPHPVMLGFVNGL
AIVIALAQLEHFKQGETWLSGDPLYLMAGLVALTMAIVYLLPRLTRSVPPALVAILGVGL
AVYLLGLPTRTLGDMAHIAGSLPAFAWPDLPWNLETLQIVVPYAVIMAMVGLLETLLTLN
LTDEITQSRGYPDRECVALGAANIASGLFGGMGGCAMIGQTVINLSSGGRGRLSGVVAGV
MVLLFVLFLSPLIERIPLAALVGVMFVVAQQTFAWASLRVINKVPKNDVLVIIAVTVITV
FTDLAVAVLCGIIIAALNFAWQQARELYADTHQEADGSKLYRLHGTLFFASTTPFLNQFD
PANDPALVTLDCRHLRFVDYSAVAALKTLRERYSKAGKHLRVFHLSERCKQMLKRAGVQH
D