Protein Info for Pf6N2E2_3441 in Pseudomonas fluorescens FW300-N2E2

Annotation: Gluconate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 104 to 133 (30 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 347 to 382 (36 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 424 to 446 (23 residues), see Phobius details PF02447: GntP_permease" amino acids 9 to 445 (437 residues), 514 bits, see alignment E=3.2e-158 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 10 to 447 (438 residues), 474.1 bits, see alignment E=2.5e-146 PF03600: CitMHS" amino acids 25 to 395 (371 residues), 59.2 bits, see alignment E=4e-20

Best Hits

Swiss-Prot: 51% identical to GNTP_ZYMMO: Gluconate permease (gntP) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 99% identity to pba:PSEBR_a699)

Predicted SEED Role

"Gluconate transporter family protein" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXR1 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Pf6N2E2_3441 Gluconate transporter family protein (Pseudomonas fluorescens FW300-N2E2)
MAPAFGYWLLVYAAIAIIALIVLIARYRLNPFIVITLVSIGLALLAGMPPSGVVGAYEAG
VGKTLGHIALVVALGTMLGKMMAESGGAERMAQTLIERFGERNAHWAMVCIAFLVGLPLF
FEVGFVLLVPIAFTIARRVGVSILMVGLPMVAGLSVVHALVPPHPAAMLAVQAFQASVGQ
TLLYAILIGIPTAIIAGPLYAKFIVPRIQLPAENPLERQFLDREPRANLPGFGVTLGTVL
LPVILMLIGGWANLISTPGSGFNQFLLFIGNSVIALLLATVLSFWTLGLAQGFNRESILK
FTNECLAPTASITLLVGAGGGLNRILVDAGVTQQIVGLAQEFQLSPLVMGWLFAALMRVA
TGSATVAMTTASGIVAPVAIGLGYPHPELLVLATGAGSVIFSHVNDGGFWLIKEYFNMTV
AQTFKTWTVLETLISVVAFGLTLGLSRLL