Protein Info for Pf6N2E2_3425 in Pseudomonas fluorescens FW300-N2E2

Annotation: Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF00005: ABC_tran" amino acids 26 to 185 (160 residues), 97.5 bits, see alignment E=2.1e-31 PF13401: AAA_22" amino acids 37 to 213 (177 residues), 28.1 bits, see alignment E=4.7e-10 PF13304: AAA_21" amino acids 153 to 220 (68 residues), 28 bits, see alignment E=4.5e-10 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 320 (86 residues), 77.4 bits, see alignment E=3.4e-26 PF08352: oligo_HPY" amino acids 237 to 300 (64 residues), 61.2 bits, see alignment E=2.1e-20

Best Hits

Swiss-Prot: 44% identical to DPPD_HAEIN: Dipeptide transport ATP-binding protein DppD (dppD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 98% identity to pba:PSEBR_a714)

MetaCyc: 47% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1L8 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Pf6N2E2_3425 Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1) (Pseudomonas fluorescens FW300-N2E2)
MSTPVLHVEDLSVIAGHGEDEVTLVDRVSFDLAKGEILGLVGESGSGKTMACRALMRLLP
SANLRVQGKALRLAGEDLLSLDEAGMRGIRGRRLGMIFQNPGSHLDPLMRIGEQIGEGIR
LHQGASKREARAKAIDVLRQVGIPDPLTRVDSYPHEFSGGMRQRAMIAVALGCNPQVLIA
DEPTTALDVTVQAQILRLLLDLRDQRGLSIIMITHDLGIVAQTCDSIAVMYAGRLCEHGN
KLDLLAHPRHPYTAALIDCQPATSAGHAMLKTIAGQPPLLDALPSGCRFNPRCLQQGSQC
TRLLPQMQVTAEAHRVACHYPLPVGASS