Protein Info for Pf6N2E2_3424 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 202 to 228 (27 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details PF12911: OppC_N" amino acids 22 to 62 (41 residues), 29 bits, see alignment 8e-11 PF00528: BPD_transp_1" amino acids 103 to 283 (181 residues), 99.3 bits, see alignment E=2.3e-32

Best Hits

Swiss-Prot: 41% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to pba:PSEBR_a715)

MetaCyc: 40% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A0K1 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Pf6N2E2_3424 Dipeptide transport system permease protein DppC (TC 3.A.1.5.2) (Pseudomonas fluorescens FW300-N2E2)
MSGQALSPTWRLALRFGLRNGRLATVLGLAILFGWLLLALFAPWVAPFDPIAQNTDIRLL
GPSLAHPFGTDNFGRDVLSRVIWGARIDLQISVIGVVFPFLIGTCVGALAGYIGGRFDTI
CMRLIDIILAFPFLVLMLAIMAILGPGLGSFYIAMALVGWVSYARLIRSQILVLKQSDFA
LAAKSLGFGHGRILFRHLLPNAMFGSIVFSMSDAVLVLLNGAAVSYLGLGVQPPTAEWGT
MVAEGQSFITNAWWICTFPGLAIVTLAMGFSLLADGVAEHLGERP