Protein Info for Pf6N2E2_3406 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00005: ABC_tran" amino acids 25 to 183 (159 residues), 125.7 bits, see alignment E=2.1e-40 PF13304: AAA_21" amino acids 139 to 212 (74 residues), 30.1 bits, see alignment E=4.9e-11

Best Hits

Swiss-Prot: 52% identical to NOCP_AGRFC: Nopaline permease ATP-binding protein P (nocP) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 78% identity to pol:Bpro_1390)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZFH6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Pf6N2E2_3406 putative ABC transporter ATP-binding protein (Pseudomonas fluorescens FW300-N2E2)
MSSPSDAALLRVHELHKNYGDLEVLKGISLELKPGETLSLIGPSGSGKSTCLRCINYLEK
PTSGEIWLGNELIGQRRDGQRSRLMSDREMAPQRREIAMVFQLFYLWPHLNVRDNVALGP
IKAQGMPRKQAYELADAMLEKVHLRHKAESYPEQLSGGQQQRVAIARALAQQPKVILFDE
PTSALDPELVGEVLAVIRELAEEGRSMIMVTHEVRFARDVADRVIFMDGGRIVEQGPSRQ
VIDNPCHERTRSFLGRMAVESA