Protein Info for Pf6N2E2_3405 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00984945: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 109 (99 residues), 77.8 bits, see alignment E=3.9e-26 PF00528: BPD_transp_1" amino acids 36 to 214 (179 residues), 53 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 36% identical to YCKA_BACSU: Probable amino-acid ABC transporter permease protein YckA (yckA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 58% identity to pol:Bpro_1389)

Predicted SEED Role

"FIG00984945: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1K4 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Pf6N2E2_3405 FIG00984945: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MANLEAFLGLLPLLLKGAMSALEIALCTLVLASVGGLVLAVLLTFSRSRLVHGAIACFIE
WMRNVPALAHLFLIYFGLSYLGINLPAWLAAIVGLSLVGSAVLADTFRAGLQSLHVGQHE
SGQAIGLHRMQTLRYILLPQALRIALPAYANYVTQLIKDTSIASAIAVPEIMFLARNLVT
STFQTSLIYLAVMCIYAAMILPIGVGFIRLERHLGAAR