Protein Info for Pf6N2E2_339 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glutathione-regulated potassium-efflux system protein KefC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 13 to 285 (273 residues), 295.5 bits, see alignment E=2e-92 PF00999: Na_H_Exchanger" amino acids 16 to 374 (359 residues), 186.8 bits, see alignment E=9e-59 PF02254: TrkA_N" amino acids 402 to 513 (112 residues), 89.3 bits, see alignment E=3.6e-29 PF27452: KefB_C" amino acids 521 to 592 (72 residues), 57.4 bits, see alignment E=2.1e-19

Best Hits

Swiss-Prot: 69% identical to KEFC_ENT38: Glutathione-regulated potassium-efflux system protein KefC (kefC) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a3523)

MetaCyc: 69% identical to K+ : H+ antiporter KefC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-42

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefC" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YSD1 at UniProt or InterPro

Protein Sequence (608 amino acids)

>Pf6N2E2_339 Glutathione-regulated potassium-efflux system protein KefC (Pseudomonas fluorescens FW300-N2E2)
VETHSLIEMLIYLASATLIVPIAVRFGLGPVLGYLLAGCIIGPWGLKLITDVKAILEFAE
IGVVLMLFIIGLELDPKRLWALRRMVFGGGALQMLACGAAIGLFCTALGLNWTAALLVGL
TLSLSSTAIAMQAMSERNLTATAVGRSSFAVLLFQDIAAIPLVAMIPLLSAHGDTPSGTA
LLLSIGKIVAAIAIVVLLGRYVTRPLLRFAARSGLREIFSAVALFLVFGFGFLLEEAGLS
MAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVGMSIDFGTLIDAPLKVVTLT
LGFILIKLLVIKMAGRFLNVPAGQRSWQAVLLGQGSEFAFVVFGAATVAGILTDQWGKSL
TLAVALSMCLTPLLIVLLDRFESVAKKNKRESDLVDQQNPRVIIAGFGRFGQIAGRLLMS
CGVEVVVLDHDPDNIETLRKFGVKVFYGDATRLDLLHAAGAAQAVVLINAIDDREDNLTL
TRLAQEHFPALQLIVRARDMGHLITLRQMGVEAAERETFESALALGRSALEHMGVGAYEA
RERADQFRRLNLKMLEEIVAQPEDDLKFRHDAYRRANALLTDMFNEDRARPVDNWQEHHR
NETDKTPG