Protein Info for Pf6N2E2_3387 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phage integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF13356: Arm-DNA-bind_3" amino acids 8 to 94 (87 residues), 81.8 bits, see alignment E=4.9e-27 PF22022: Phage_int_M" amino acids 107 to 200 (94 residues), 78.3 bits, see alignment E=6.5e-26 PF00589: Phage_integrase" amino acids 214 to 377 (164 residues), 109.4 bits, see alignment E=2.7e-35

Best Hits

Swiss-Prot: 50% identical to INTA_ECOLI: Prophage integrase IntA (intA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to pfo:Pfl01_0747)

Predicted SEED Role

"Phage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXK8 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Pf6N2E2_3387 Phage integrase (Pseudomonas fluorescens FW300-N2E2)
MPTNATRLSDRQLKAVKATGKDFVLSDGDGLQLRVRASGSMMWNFNYREPLTRSRINMAL
GPYPDLSLANARKKAVEARELLALGIDPKAQRDEVRHAKLAETEHTFEKVATAWFELKKD
SVTKAYGEDIWRSLTLHVLPSMKTTPLSQITAPMVIKILRPIEAKGSLETVKRLSQRLNE
IMTYGVNSGLIFANPLNGIRAVFKKPKKENMAALPPEELPELMMEIANASIKRTTRCLIE
WQLHTMTRPAEAATTRWADIDFNKRIWTIPPERMKKRRPHTIPLTDQALALLETLKQLSG
NREYVFPSDRNPRTHANSQTANMALKRMGFQDRLVSHGLRSMASTILNEHGWDPELIEVA
LAHVDKDEVRSAYNRTDYIERRRPMMAWWSEHIQKAAIGSLSASAINQTRDRNVVPIR