Protein Info for Pf6N2E2_3356 in Pseudomonas fluorescens FW300-N2E2

Annotation: Triosephosphate isomerase (EC 5.3.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR00419: triose-phosphate isomerase" amino acids 1 to 236 (236 residues), 211.3 bits, see alignment E=8.6e-67 PF00121: TIM" amino acids 1 to 244 (244 residues), 304.6 bits, see alignment E=2.7e-95

Best Hits

Swiss-Prot: 94% identical to TPIS_PSEPF: Triosephosphate isomerase (tpiA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 94% identity to pba:PSEBR_a776)

MetaCyc: 50% identical to triose-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1G5 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Pf6N2E2_3356 Triosephosphate isomerase (EC 5.3.1.1) (Pseudomonas fluorescens FW300-N2E2)
MVAGNWKMHGTRASVAELIKGLRHLALPSGVDVAVFPPCLYINQVVDGLKGKSISVGAQN
SAVESMQGALTGEIAPSQLVDAGCSLVLIGHSERRQIMGEQDKALIRKFSAAQACGLIPV
LCVGETREQREAGKTLEVVGRQLGGIIEELGVDAFAKAVIAYEPVWAIGTGLTASPQQAQ
DVHAAIRAQLAAENSEVARGVRLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN