Protein Info for Pf6N2E2_3338 in Pseudomonas fluorescens FW300-N2E2

Annotation: 1-phosphofructokinase (EC 2.7.1.56)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR03168: hexose kinase, 1-phosphofructokinase family" amino acids 4 to 307 (304 residues), 343.1 bits, see alignment E=1.1e-106 TIGR03828: 1-phosphofructokinase" amino acids 4 to 307 (304 residues), 348.4 bits, see alignment E=2.9e-108 PF00294: PfkB" amino acids 9 to 290 (282 residues), 175.6 bits, see alignment E=7.8e-56

Best Hits

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 98% identity to pba:PSEBR_a792)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXK4 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Pf6N2E2_3338 1-phosphofructokinase (EC 2.7.1.56) (Pseudomonas fluorescens FW300-N2E2)
MAKILTLTLNPALDLTVELTRLEPGQVNRSDGMHAHAAGKGVNVAQVLADLGHTLTVSGF
LGEDNAQVFETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGPVVDEAAQQAL
LARLEQIAPGHDVVVVAGSLPRGVSPQWLQALITRLKTLGLNVALDTSGEALRVALAAGP
WLIKPNTEELADALGCEVVSEAAQAQAAQHLHAQGVEHVVISHGADGVNWFSVGAALHAS
PPKVSVASTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIHDTALLAS
LEQGVRVRPLTEQ