Protein Info for Pf6N2E2_3337 in Pseudomonas fluorescens FW300-N2E2

Annotation: PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 239 to 265 (27 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details amino acids 314 to 338 (25 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details amino acids 437 to 460 (24 residues), see Phobius details amino acids 472 to 492 (21 residues), see Phobius details amino acids 498 to 518 (21 residues), see Phobius details amino acids 539 to 560 (22 residues), see Phobius details PF02302: PTS_IIB" amino acids 1 to 88 (88 residues), 40.4 bits, see alignment E=3.9e-14 amino acids 120 to 209 (90 residues), 78.5 bits, see alignment E=4.8e-26 TIGR00829: PTS system, Fru family, IIB component" amino acids 119 to 202 (84 residues), 113.6 bits, see alignment E=4.3e-37 TIGR01427: PTS system, Fru family, IIC component" amino acids 228 to 561 (334 residues), 476.8 bits, see alignment E=4.6e-147 PF02378: PTS_EIIC" amino acids 242 to 505 (264 residues), 79.8 bits, see alignment E=2e-26

Best Hits

Swiss-Prot: 66% identical to PTFBC_ECOLI: PTS system fructose-specific EIIB'BC component (fruA) from Escherichia coli (strain K12)

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 97% identity to pba:PSEBR_a793)

MetaCyc: 66% identical to fructose-specific PTS multiphosphoryl transfer protein FruA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZA0 at UniProt or InterPro

Protein Sequence (575 amino acids)

>Pf6N2E2_3337 PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69) (Pseudomonas fluorescens FW300-N2E2)
VTACPNGMVTSVLCARLLDAAAQRQGWSTSVEVHDAAHPERQLSAATLEAAEWVLLVASG
PVDMSRFVGKRLFRSTPALALQDVDSVLRRGAEEAEVFLASDVVEQAPAVSTDRAPRLVA
ITACPTGVAHTFMAAEALQQAATKLGYDLQVETQGSVGARNPLSAEAIAEADVVLLATDI
EVATERFAGKKIYRCSTGIALKQAEATLNKALVEGRQESASSGASAPAKSEKTGVYKHLL
TGVSFMLPMVVAGGLMIALSFVFGIEAFKEPGTLAAALMQIGGDTAFKLMVPLLAGYIAY
SIADRPGLAPGMIGGMLASTLGAGFIGGIIAGFLAGYAAKAISRYARLPQSLEALKPILI
IPLLASLFTGLVMIYIVGKPVAGMLEALTHFLDSMGTTNAILLGVLLGAMMCVDLGGPIN
KAAYAFSVGLLASQSYAPMAATMAAGMVPPIGLGIATFIARRKFAQTEREAGKAALVLGL
CFISEGAIPFAAKDPLRVIPASIAGGALTGALSMYFGCKLMAPHGGLFVMLIPNAINHAL
LYLLAIVAGSLLTGVAYALLKRPEVVEMALEPAKA