Protein Info for Pf6N2E2_3327 in Pseudomonas fluorescens FW300-N2E2

Annotation: Peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 TIGR00503: peptide chain release factor 3" amino acids 5 to 528 (524 residues), 869.3 bits, see alignment E=8.2e-266 PF00009: GTP_EFTU" amino acids 13 to 276 (264 residues), 162.3 bits, see alignment E=3.2e-51 TIGR00231: small GTP-binding protein domain" amino acids 17 to 148 (132 residues), 58.4 bits, see alignment E=7.6e-20 PF22042: EF-G_D2" amino acids 294 to 380 (87 residues), 92.7 bits, see alignment E=3.6e-30 PF03144: GTP_EFTU_D2" amino acids 313 to 379 (67 residues), 52.3 bits, see alignment E=1.9e-17 PF16658: RF3_C" amino acids 386 to 513 (128 residues), 159.1 bits, see alignment E=1.5e-50 PF14492: EFG_III" amino acids 398 to 462 (65 residues), 27.8 bits, see alignment E=6.4e-10

Best Hits

Swiss-Prot: 97% identical to RF3_PSEPF: Peptide chain release factor 3 (prfC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 98% identity to pba:PSEBR_a801)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZZ92 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Pf6N2E2_3327 Peptide chain release factor 3 (Pseudomonas fluorescens FW300-N2E2)
MSDSKIVNEVNARRTFAIISHPDAGKTTITEKLLLMGKAIAVAGTVKSRKSDRHATSDWM
EMEKQRGISITTSVMQFPYRDHMINLLDTPGHEDFSEDTYRTLTAVDSALMVLDGGKGVE
PRTIALMDVCRLRDTPIVSFINKLDRDIRDPIELLDEIEAVLKIKAAPITWPIGCYRDFK
GVYHLADDYIIVYTAGHGHERTEVKIIDKLDSDEARAHLGDEYERFVEQLELVQGACHEF
NQQEFLDGQLTPVFFGTALGNFGVDHVLDAVVNWAPRPLARIANERTVEPVEEKFSGFVF
KIQANMDPKHRDRIAFMRICSGKYEKGMKMRHVRTGKDVRIGDALTFFSSEREQLEEAFA
GDIIGLHNHGTIQIGDTFTEGETLGFTGIPHFAPELFRRVRLKDPLKSKQLRQGLQQLAE
EGATQVFFPTRSNDIILGAVGVLQFDVVASRLKEEYKVECSYEPITVYSARWVECGDKKK
LEEFSNKAVENLALDGGGHLTYLAPTRVNLALMEERWPDVKFRATREHH