Protein Info for Pf6N2E2_3314 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00005: ABC_tran" amino acids 30 to 182 (153 residues), 124.5 bits, see alignment E=4.7e-40 PF08352: oligo_HPY" amino acids 233 to 298 (66 residues), 70.3 bits, see alignment E=1.4e-23 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 233 to 317 (85 residues), 92.8 bits, see alignment E=5.4e-31

Best Hits

Swiss-Prot: 62% identical to DPPF_HAEIN: Dipeptide transport ATP-binding protein DppF (dppF) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K12372, dipeptide transport system ATP-binding protein (inferred from 98% identity to pba:PSEBR_a803)

MetaCyc: 61% identical to dipeptide ABC transporter ATP binding subunit DppF (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZEW0 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Pf6N2E2_3314 Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2) (Pseudomonas fluorescens FW300-N2E2)
MAVVLTARDLTRHYEVSRGMFKGHATVRALNGVSFELEAGKTLAVVGESGCGKSTLARAL
TLIEEPSAGSLKIAGQEVAGANKAERKQLRKDVQMVFQSPYASLNPRQKIGDQLAEPLLI
NTKLSATERREKVQAMMKQVGLRPEHYQRYPHMFSGGQRQRIALARAMMLQPKVLVADEP
TSALDVSIQAQVLNLFMDLQQEFNTAYVFISHNLAVVQHVADDVMVMYLGRPVEMGPNES
IYSRPLHPYTQALLSATPTIHPDPNKPKIKIVGELPNPLNPPSGCAFHKRCPYATERCKT
EEPALRPLDNRLVACHYAERFLAGAA