Protein Info for Pf6N2E2_3307 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00496: SBP_bac_5" amino acids 71 to 457 (387 residues), 332.9 bits, see alignment E=1.3e-103

Best Hits

KEGG orthology group: K12368, dipeptide transport system substrate-binding protein (inferred from 98% identity to pba:PSEBR_a810)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) or Bacterial Chemotaxis (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXE8 at UniProt or InterPro

Protein Sequence (541 amino acids)

>Pf6N2E2_3307 Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2) (Pseudomonas fluorescens FW300-N2E2)
MLKQAVIPFLVGASLLASAPFAQAATNLVFCSEGSPAGFDPGQYTTGTDFDASAETMFNR
LTQFERGGTAVIPGLATKWDISDDGLTYTFHLREGVKFHTTPYFKPTREFNADDVLFTFN
RMISKDDPFRKAYPTEFPYFTDMGMDTNITQIDKVDDHTVKFTLKDVDAAFIQNMAMSFA
SIQSAEYAAQLLKEGKAPDINQKPVGTGPFVFKSYQKDSNIRYTGNKDYWKPDDVKIDNL
IFAITTDPSVRMQKLKKNECQITLFPRPADLKALKEDKTLKMPDQAGFNLGYIAYNVMDK
IKGSNEPNVLANLKVRQALDMAVNKPQIIDSVYQGAGQLAVNAMPPTQWSYDTTIKDAKY
DPEKAKELLKEAGVKEGTNITLWAMPVQRPYNPNAKLMAEMLQSDWKKIGLNVNIVSYEW
GEYIKRSKGGENQAMIIGWSGDNGDPDNWLNVLFGCDSLAGNNFSKWCDKKFDGLVKEAK
RTTDQAKRTELYKQAQHVLKDAVPMTPIAHSTVYQPMRANVQDFKISPFGLNSFYGVSVS
K