Protein Info for Pf6N2E2_3284 in Pseudomonas fluorescens FW300-N2E2

Annotation: Septum formation protein Maf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR00172: septum formation protein Maf" amino acids 2 to 184 (183 residues), 170.5 bits, see alignment E=1.4e-54 PF02545: Maf" amino acids 3 to 186 (184 residues), 200.8 bits, see alignment E=8.2e-64

Best Hits

Swiss-Prot: 83% identical to NTPPA_PSEPF: dTTP/UTP pyrophosphatase (Pfl01_0841) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K06287, septum formation protein (inferred from 96% identity to pba:PSEBR_a830)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZEQ3 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Pf6N2E2_3284 Septum formation protein Maf (Pseudomonas fluorescens FW300-N2E2)
MKPLYLASGSPRRRELLTQIGVPFTAVGADIDETPLDHETPSAYVERLARGKAEAGRRAL
DAGMDGCVLGADTAVVLDGRILGKPVDQADSMAMLLSLSGREHEVLTAIAILGGQRCESR
VVRSLVRFRSITEQEAAAYWASGEPRDKAGGYGIQGLGAVFVAGLEGSYSAVVGLPLCET
AELLGHFGIPCWQTLSAR