Protein Info for Pf6N2E2_3283 in Pseudomonas fluorescens FW300-N2E2

Annotation: Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 TIGR00757: ribonuclease, Rne/Rng family" amino acids 14 to 422 (409 residues), 520.9 bits, see alignment E=1.2e-160 PF00575: S1" amino acids 38 to 100 (63 residues), 35.1 bits, see alignment E=2.2e-12 PF10150: RNase_E_G" amino acids 115 to 389 (275 residues), 358.6 bits, see alignment E=3.3e-111 PF20833: RNase_E_G_Thio" amino acids 400 to 482 (83 residues), 27.6 bits, see alignment E=3.8e-10

Best Hits

Swiss-Prot: 56% identical to RNG_SHIFL: Ribonuclease G (rng) from Shigella flexneri

KEGG orthology group: K08301, ribonuclease G [EC: 3.1.26.-] (inferred from 100% identity to pba:PSEBR_a831)

MetaCyc: 56% identical to RNase G (Escherichia coli K-12 substr. MG1655)
Ribonuclease E. [EC: 3.1.26.12]

Predicted SEED Role

"Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-)" in subsystem Bacterial Cell Division or RNA processing and degradation, bacterial (EC 3.1.4.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.12, 3.1.4.-

Use Curated BLAST to search for 3.1.26.- or 3.1.26.12 or 3.1.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1A6 at UniProt or InterPro

Protein Sequence (485 amino acids)

>Pf6N2E2_3283 Cytoplasmic axial filament protein CafA and Ribonuclease G (EC 3.1.4.-) (Pseudomonas fluorescens FW300-N2E2)
MSEEILINITPMESRVAVVENGVLQEVHVERTQKRGIVGNIYKGKVVRVLPGMQAAFVDI
GLDRAAFIHASEISMREGPAVESISALVHEGQSLVVQVTKDPIGSKGARLTTQLSIPSRY
LVYMPRTAHVGISLKIEDEAERERLKQVVSDCVEKEGIKEAGGFILRTAAEGAGGDEILM
DIRYLRRLWDQIAAQIKTIATPSVIYEDLGLALRTLRDLVSPKIEKIRIDSRETFQKTTQ
FVAELMPEIADRLEHYPGERPIFDLYGVEDEIQKALERKVPLKSGGYLVVDPAEAMSTID
VNTGAFVGHRNLEETIFKTNLEAATAIARQLRLRNLGGIIIIDFIDMEDEEHQRQVLRTL
EKQLERDHAKTNIIGITELGLVQMTRKRTRESLEQVLCEPCSSCQGRGKLKTPETVCYEI
FREILREARAYQATGYRVLANQKVVDRLLDEESGNVAELEAFIGRTIRFQVETMYSQEQY
DVVLL