Protein Info for Pf6N2E2_3279 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG138315: Putative alpha helix protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF04751: DUF615" amino acids 13 to 164 (152 residues), 188.9 bits, see alignment E=2.6e-60

Best Hits

Swiss-Prot: 95% identical to Y846_PSEPF: UPF0307 protein Pfl01_0846 (Pfl01_0846) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K09889, ribosome-associated protein (inferred from 99% identity to pba:PSEBR_a835)

Predicted SEED Role

"FIG138315: Putative alpha helix protein" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0D9ASL5 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Pf6N2E2_3279 FIG138315: Putative alpha helix protein (Pseudomonas fluorescens FW300-N2E2)
MVDSYDDSLYEGEKSKSQVKRELHALVDLGERLTTLKPDLLAKLPLTDALRRALADAPKH
TANIARKRHLQFIGKLMRDQDTDAILVLLDQLDASTRQYNERFHNLERWRDRLIAGDDGT
LEKFVIDYPEADRQQLRSLIRQAQHELAQNKPPASSRKIFKYIRELDETQRGLR