Protein Info for Pf6N2E2_3274 in Pseudomonas fluorescens FW300-N2E2

Annotation: Manganese superoxide dismutase (EC 1.15.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF00081: Sod_Fe_N" amino acids 3 to 89 (87 residues), 112.2 bits, see alignment E=1.3e-36 PF02777: Sod_Fe_C" amino acids 96 to 197 (102 residues), 130.7 bits, see alignment E=2e-42

Best Hits

Swiss-Prot: 81% identical to SODM_PSEPU: Superoxide dismutase [Mn] (sodA) from Pseudomonas putida

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 92% identity to pba:PSEBR_a840)

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZEM8 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Pf6N2E2_3274 Manganese superoxide dismutase (EC 1.15.1.1) (Pseudomonas fluorescens FW300-N2E2)
MAFTLPALPYAYDALEPHIDAQTMEIHYTKHHQTYINNLNAAVDGTEYAEWPVEKLLSSI
EQLPQSLRAAVINQGGGHANHSLFWEVMAPQGGGHPEGALAAAIEAQLGGLERFKEAFTK
AALTRFGSGWAWLSVTPQKTLVVESSGNQDSPLMNGHTPILGLDVWEHAYYLLYQNRRPE
YINAFYNVINWPEVARRYRAALA