Protein Info for Pf6N2E2_3272 in Pseudomonas fluorescens FW300-N2E2

Annotation: Metal transporter, ZIP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details PF02535: Zip" amino acids 13 to 121 (109 residues), 43.3 bits, see alignment E=1.4e-15

Best Hits

Predicted SEED Role

"Metal transporter, ZIP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>Pf6N2E2_3272 Metal transporter, ZIP family (Pseudomonas fluorescens FW300-N2E2)
MAVGVSAGGGMPDADSLAMGIALQDVPEGLVIALVLAAAGMSRLKAFAIGAASGLVEPVF
ALLCAWLVSLAEMLLPLGLALAAGAMLLVVTHEVIPESRRNGHDKLASLGLLVGFCLMMV
MDTALA