Protein Info for Pf6N2E2_3255 in Pseudomonas fluorescens FW300-N2E2

Annotation: YrbA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 PF01722: BolA" amino acids 22 to 71 (50 residues), 30.8 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 41% identical to Y1082_HAEIN: Uncharacterized protein HI_1082 (HI_1082) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a857)

Predicted SEED Role

"YrbA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WWC7 at UniProt or InterPro

Protein Sequence (79 amino acids)

>Pf6N2E2_3255 YrbA protein (Pseudomonas fluorescens FW300-N2E2)
MQAVEVKSFLEGKLPGTQVEVEGEGCNFQLNVISDELAALSPVKRQQSIYAHLNPWIADG
SIHAVTMKFFSSAAWAERT