Protein Info for Pf6N2E2_3245 in Pseudomonas fluorescens FW300-N2E2

Annotation: L-lysine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 205 (190 residues), 124.8 bits, see alignment E=1.6e-40

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a867)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160A1A0 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Pf6N2E2_3245 L-lysine permease (Pseudomonas fluorescens FW300-N2E2)
MYLAEFLTVALIHLLAVASPGPDFAVVVRESVTHGRRAGTWTALGVGTAIFLHVGYSLLG
IGLIVSQSIVLFNALKWAAAAYLLYIGFKALRAQPAKPTEDNLHKEAGERTPRGAFTSGF
VTNGLNPKATLFFLSLFTVVINPHTPLAVQAGYGVYLAVATAAWFCLVALLFSQQRVRAG
FARMGHWFDRTMGAVLVAIGVKLAFTEAH