Protein Info for Pf6N2E2_3232 in Pseudomonas fluorescens FW300-N2E2

Annotation: Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 145 to 170 (26 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 18 to 87 (70 residues), 33.3 bits, see alignment E=5e-12 PF00528: BPD_transp_1" amino acids 124 to 345 (222 residues), 136.2 bits, see alignment E=1.1e-43

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to pba:PSEBR_a882)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165ZEB4 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Pf6N2E2_3232 Dipeptide transport system permease protein DppB (TC 3.A.1.5.2) (Pseudomonas fluorescens FW300-N2E2)
MSTASFSIWTTRAASATRRGGSVAVTLLGLLLLTFFIGRVMPLDPVLAIVGPDADASAYA
QVYKELGLDKPLWTQFAIYLGDLLHGDFGMALLTGNPVITDIARVFPATLELATLAILFG
VLAGLPLGVYAATHQGRAGDHVARLITLFGYSTPIFWIGMMAFLVFYAWLGWAGGVGRIG
LAYDGLIPKHTGLLLIDTAWSGDWEAFRSALRHILLPAVILSFNSVAYISRMTRSFMLEQ
LSQEYIITARVKGLSQRRIVWGHAFGNIRVQLLTIVALAYGGLLEGAVLIETVFAWPGFG
QYLTSSLLLGDMNAVMACVLLIGLIFVTLNLISDALYKIFDPRTR